PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016454454.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 1087aa    MW: 123306 Da    PI: 9.5076
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016454454.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3376.2e-1227116198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffk+    + ++++rl++p +fa+++ ++  ++  + le ++g++Wev++    ++g++ l+ GW++F +   +  g f++F ++ rs f  +v+
  XP_016454454.1  27 FFKII--LSQHERSRLRIPEDFASRYCKNMLNP--VYLEVPTGEVWEVEV--VHSQGQICLGIGWQDFSDFYSISCGHFLMFGYNARSHF--NVT 113
                     67777..78889999***********5454444..***************..999999**************************999999..999 PP

                     EE- CS
              B3  96 vfr 98 
                     +f+
  XP_016454454.1 114 IFD 116
                     987 PP

2B3407.2e-13280357487
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      + ps+v++  +l+++ kfa+++ +++ +   l+l+ +   sW+vk+++  +  +++    Wk Fv +n+Lk gD++vF++++ 
  XP_016454454.1 280 FMQPSYVFSPFNLSMSLKFARKYFLENYR--NLVLRVPGRGSWSVKCTFGTTNAKIF----WKAFVMDNKLKPGDVCVFEVIKG 357
                     5789*******************887545..7***************8866655554....*******************8764 PP

3B3474.5e-15530619497
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      + ps+v+k  +l ++ +f++++  ++ +    +l+ +   sW+v++    + ++  +++GWk Fv +n+Lk gD++vF++++ ++  + v++f
  XP_016454454.1 530 FMQPSYVSKPYNLNISATFIRKYFRDEYS--NFVLRVPGRGSWSVEC--FMGTSKAQIRSGWKAFVLDNKLKHGDVCVFEVIKVTKLLMDVTIF 619
                     6789*******************777555..69**************..334444559**********************99877776777776 PP

4B334.73.1e-11793881799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ps+v++  rl +    a+++  + +++  l+l  +   sW+vk+   k++ ++ +   Wk Fv +n+Lk gD++vF+l++ ++  l v++fr+
  XP_016454454.1 793 PSYVSTPYRLDITFLLARKYLWE-KCG-FLVLHVPGRGSWSVKYVLGKSKTKICFY--WKAFVLDNKLKFGDVCVFELIKGTKPILDVTIFRT 881
                     66666666666666667666322.233.588899999*******999999999999..*********************88777788888885 PP

5B349.67.2e-169921078794
                      .-HHHHT...T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3    7 psdvlks...grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94  
                      ps+v++     +l++  + a+++   k++  +++l+++s rsW vk+  + +     lt+GWkeFv +n+Lkeg ++vF++++rs+  ++v
  XP_016454454.1  992 PSYVSSAsgpMQLSITLPIARKFFATKHS--DVILQNSSKRSWAVKC--SLGTVNAKLTSGWKEFVLDNDLKEGHICVFERVSRSKLLFNV 1078
                      44444445567899999999999766444..8***************..55555677***********************88776664444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.9E-1819118IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-1721118IPR015300DNA-binding pseudobarrel domain
CDDcd100179.90E-1125116No hitNo description
PROSITE profilePS5086311.16625118IPR003340B3 DNA binding domain
PfamPF023621.9E-827116IPR003340B3 DNA binding domain
SMARTSM010192.6E-828118IPR003340B3 DNA binding domain
SuperFamilySSF1019369.02E-15270360IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.8E-16270366IPR015300DNA-binding pseudobarrel domain
CDDcd100171.02E-14275368No hitNo description
SMARTSM010197.8E-9276370IPR003340B3 DNA binding domain
PROSITE profilePS508639.22277370IPR003340B3 DNA binding domain
PfamPF023623.0E-10279357IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.2E-21519622IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.67E-19520620IPR015300DNA-binding pseudobarrel domain
CDDcd100173.88E-15525620No hitNo description
SMARTSM010196.8E-11526622IPR003340B3 DNA binding domain
PROSITE profilePS5086311.773527622IPR003340B3 DNA binding domain
PfamPF023626.1E-12529619IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.6E-16779880IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.61E-16780880IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.123787882IPR003340B3 DNA binding domain
SMARTSM010191.8E-6790882IPR003340B3 DNA binding domain
CDDcd100175.26E-13791880No hitNo description
PfamPF023621.5E-8793880IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-229781082IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.37E-189811082IPR015300DNA-binding pseudobarrel domain
CDDcd100171.87E-149841081No hitNo description
PROSITE profilePS5086312.4789891084IPR003340B3 DNA binding domain
SMARTSM010196.9E-99891084IPR003340B3 DNA binding domain
PfamPF023629.0E-149961080IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1087 aa     Download sequence    Send to blast
MAAKPQLQNG EGSSHWKSST NITQPKFFKI ILSQHERSRL RIPEDFASRY CKNMLNPVYL  60
EVPTGEVWEV EVVHSQGQIC LGIGWQDFSD FYSISCGHFL MFGYNARSHF NVTIFDLSAS  120
EIEYPYSSAH GIHTPISYSH ETRHAPERDQ SESDDSVEIL EGIPRSQKAN PIIPDMVENS  180
VENLDHCPLG QSSKRQRQEG DTEDDVFVDM HIKRMKVEKL QEDVASFTRE GQKSSEGCCT  240
HMQQSKIVYD ENKTVMDKER AIAYQRAKGF KSKNPFVISF MQPSYVFSPF NLSMSLKFAR  300
KYFLENYRNL VLRVPGRGSW SVKCTFGTTN AKIFWKAFVM DNKLKPGDVC VFEVIKGAKI  360
LMDITIFPAA GSTPMHKIAG EVPWVSDKSV PFSQSRIVQT KNLKQRRGGV CGFNSKVKEH  420
GEGIGIEHSF EILGHCPLGQ YRKITRLERD AEDDVPFDTH TKNIKVETSQ EDVALPSFRK  480
TKKSGESCRM HTQQTTIVCG KNKTVMDKER AMAYQRAKAF KSKNPFIISF MQPSYVSKPY  540
NLNISATFIR KYFRDEYSNF VLRVPGRGSW SVECFMGTSK AQIRSGWKAF VLDNKLKHGD  600
VCVFEVIKVT KLLMDVTIFP ATGSTPMLKI AGEVTGVSDS KRKIIKTDIY VPCSPPKVVH  660
TNRLKQRRGE EHDEGTGIES SVEILGHCPL GHDSKIKRLE VETEDDVSID IHAKNIKVAN  720
TQEDVASPSF TRKTKNFEFL YEESGESCRM DKQQSKMVYD KNTTVLDKER TVAYQRAKDF  780
KSENPYVMYF MQPSYVSTPY RLDITFLLAR KYLWEKCGFL VLHVPGRGSW SVKYVLGKSK  840
TKICFYWKAF VLDNKLKFGD VCVFELIKGT KPILDVTIFR TAESKPVHKI DGKLSGVSDC  900
KNKTIKTENS VPCSQSKIVR SRKLNLEKRQ NGNSDGFTSK TKEELSEDAG KHVQQSKSSC  960
KGSAVAKEMV LAYQRAKAFT SENPFFICFM QPSYVSSASG PMQLSITLPI ARKFFATKHS  1020
DVILQNSSKR SWAVKCSLGT VNAKLTSGWK EFVLDNDLKE GHICVFERVS RSKLLFNVII  1080
FTSAEGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A9e-1650061922140B3 domain-containing transcription factor VRN
4i1k_B9e-1650061922140B3 domain-containing transcription factor VRN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454454.10.0PREDICTED: uncharacterized protein LOC107778682 isoform X2
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.16e-32B3 family protein